PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019801.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 422aa    MW: 46641.3 Da    PI: 7.2131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019801.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
      Pbr019801.1 14 RGPWSPEEDGKLKSYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding37.27e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Pbr019801.1  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.326962IPR017930Myb domain
SuperFamilySSF466895.72E-2611109IPR009057Homeodomain-like
SMARTSM007171.9E-111364IPR001005SANT/Myb domain
PfamPF002493.6E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-241569IPR009057Homeodomain-like
CDDcd001676.57E-91662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.6E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2370117IPR009057Homeodomain-like
CDDcd001673.99E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDGKLKSYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
QRKEHQLARK SGLVKQDIIK RSGGVGGNSN SHSAILAADG QNSYWPELPV LAAPTVLPQQ  180
QQQPCFNDHA SIRKLLIKLG GRFSSDINHN HDTNQATQDS STDIQPTYQV LDDNNNIPYA  240
ATAVTPTHQM DEHYSGKNMQ SLLVPRHGIH ALNNSSAPVA LSNIDVISPH QFAQTHYMVN  300
TDNIDGAGNG IMHNMFQGQG GNYVTDHLKE MAVYNNNNTD NQQRFDGMEF LYGDEMMIMN  360
NRIISSYGES IGWGEMLGCP PVASSSDDYN AGMDRLMPAA PVQECGFAND QLMSSYPGAP  420
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361362.10.0PREDICTED: transcription factor RAX1-like
TrEMBLM5XI081e-155M5XI08_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0002s11440.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.15e-80myb domain protein 84